SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003559 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003559
Domain Number 1 Region: 1023-1105
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 721-780
Classification Level Classification E-value
Superfamily BPTI-like 1.36e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 3 Region: 1108-1195
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-18
Family I set domains 0.053
Further Details:      
 
Domain Number 4 Region: 889-969
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000353
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 277-335
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 341-399
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 461-513
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 398-455
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 9 Region: 26-58
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000824
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003559   Gene: ENSNLEG00000002925   Transcript: ENSNLET00000003733
Sequence length 1251
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:7601871:7636709:1 gene:ENSNLEG00000002925 transcript:ENSNLET00000003733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWGQWSPCSRTCGGGVSFRERPCYSQSRSR
GCWLLGVEWSHLKSKLQSGCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYGAPNKCELN
CIPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLQCGGDS
TTCWLPFSAARPCGLLCAAVKNVRGEYYLNGHWTIEAARALPAASTILHYERGAEGDLAP
ERLHARGPTSEPLVIELISQEPNSGVHYEYHLPLHHPGPGFSWSHGSWSDCSVECGGGHQ
SRLVFCTIDHEAYPDYMCQRQPRPAARRSCNLHPCPETKRWKAGPWTPCSASCGGGSQSR
SVYCISSDGAGVQEAVEEAECAGLRGKPPAIQACNLQRCAAWSPEPWGECSVSCGVGIRR
RSVTCRGDRGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWLVGTWGLCSKSCSSGTR
RRQVICAIGPPSHCGSLQHSKPVDVEPCNMQPCHLPQEVPSMQDVHTPASNPWMPLGPQE
SPASDSRGQWWAAQEHPSARRDHRGERVDPRGDQGTHLSALGPAPSLQQPPYQQPLQSDS
GPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQSRYGCCPDRVSVAEGPHHAGCEFHH
SDSTGSRPRSRAVASTVHNTQQPQAQQNEPSECRGSQFGCCYDNMATAAGPLGEGCVGQP
SHAYPVQCLLPSAHGSCTDWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQG
SLHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQHRTGAAVQRKPWSSGGLWWQDQQPGP
GEAPHTQAFGEWPWRQELGSRAPGLGGDAGSPAPPFHSSSYRISLAGVEPSLVQAALGQL
VRLSCSDDTTPESQAAWQKDGQPISSDRHRLQSDGSLIIHPLQAEDAGIYSCGSTRPGLD
SQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQVGAAGPLGAIPSSHPQPANRLRLD
QNQPWVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISRVAVED
GGFYTCVAFNGQDRDQRWVQLRVLEELTISGLPPTVTVPEGDTARLLCVVAGESVNIRWS
RNGLPVQADGHRVHQSPDGTLLIYNLRARDEGSYTCSAYQGSRAVSRSTEVKVVSPALTA
QPRDPGRECIDQPELANCDLILQAQLCGNEYYSSFCASCSRFQPHAQPIWQ
Download sequence
Identical sequences ENSNLEP00000003559 ENSNLEP00000003559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]