SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003570 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003570
Domain Number 1 Region: 597-802
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-33
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-29
Family Fibronectin type III 0.00000167
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 6.96e-21
Family I set domains 0.00043
Further Details:      
 
Domain Number 4 Region: 410-502
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 226-312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.0031
Further Details:      
 
Domain Number 6 Region: 499-602
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-18
Family V set domains (antibody variable domain-like) 0.084
Further Details:      
 
Domain Number 7 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-16
Family I set domains 0.00021
Further Details:      
 
Domain Number 8 Region: 124-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000365
Family I set domains 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003570   Gene: ENSNLEG00000002884   Transcript: ENSNLET00000003745
Sequence length 1028
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:6402645:6659158:-1 gene:ENSNLEG00000002884 transcript:ENSNLET00000003745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLNCEARGNPSPHY
RWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAY
LENFKTKMRSAVSVREGQGVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGH
LYISKVEPSDVGNYTCVVTSMVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAA
KGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAE
NSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKDGAALVL
EERIQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ
VQVGSLVSLDCKPRASPRARSSWKKGDVSVQEHERISLLKDGGLKIANVTKADAGTYTCM
AENQFGKASGTTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGA
LADFKKEGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGP
PENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEVIDGKTHTA
TVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSELVIT
WDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGV
YNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV
RYWNGGGKEESSSKVKVAGNETSARLQGLKSNLAYYTAVRAYNSAGSGPFSATVNVTTKK
TPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSA
ELLLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPMVL
FLIVYALW
Download sequence
Identical sequences G1QRK2
ENSNLEP00000003570 XP_003264956.1.23891 ENSNLEP00000003570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]