SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003576 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003576
Domain Number 1 Region: 46-216
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-29
Family C-type lectin domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003576   Gene: ENSNLEG00000002936   Transcript: ENSNLET00000003751
Sequence length 225
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1264215:1299414:-1 gene:ENSNLEG00000002936 transcript:ENSNLET00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQQAIYAELSLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSTEKCSVDIQQNRNKTTERPVLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELTHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCIYISQTSVYSEYCSTEIRWICQKELTPVKNKVYPDS
Download sequence
Identical sequences A0A2I3HVQ3
XP_003265505.1.23891 ENSNLEP00000003576 ENSNLEP00000003576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]