SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003589 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003589
Domain Number 1 Region: 48-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000279
Family Growth factor receptor domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003589   Gene: ENSNLEG00000002783   Transcript: ENSNLET00000003764
Sequence length 993
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:8011640:8079320:1 gene:ENSNLEG00000002783 transcript:ENSNLET00000003764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRGGAGVAMEAWSLLSARAVTAFLLLLLPRFLQAQTFSFPFQQPEKCDNNQYFDISAL
SCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPKNMKGVTEDGWNCISCPSG
LTAEGKCHCPTGHILVERDVNGTLLSQATCELCDGNENSFTVANALGDRCVRCEPTFVNT
SRSCACSEPNILTGGLCFSSTGNFPLRRISTARYGDVGMSLTSEWFAKYLQSSAAACWVY
ANLTSCQALGNMCVMNMNSYDFATFDACRLFQFIFENTAGLSTVHSISFWRQNLPWLFYG
DHLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLEGGVLQLCPDT
ETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL
QHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGSQPRVIRVATQISLSVHLVPNTIN
GNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASL
LKTAGWKRRIGSPMIDLQTVMKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLL
PMPVQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPKGKVLKAVEGEGGVRS
ATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRSP
PSYIAPYSRILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCCMSNISVFLL
SHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR
QHYERIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHNEMDYFIKISC
FIILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASF
LTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI
Download sequence
Identical sequences ENSNLEP00000003589 ENSNLEP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]