SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003590 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003590
Domain Number 1 Region: 36-154
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-27
Family C-type lectin domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003590   Gene: ENSNLEG00000002956   Transcript: ENSNLET00000003765
Sequence length 194
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1357718:1387037:1 gene:ENSNLEG00000002956 transcript:ENSNLET00000003765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDSNNVEKDIAPSELPANPGYLHSKEHSIKATLIWPLFFLIMFLTIIVCGMVAALSAIR
ANCHQKPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELN
FLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQLVIKEDGANLYVANVSQVPRMNPKPV
MVSYPGSRRVCLFE
Download sequence
Identical sequences G1QRM2
ENSNLEP00000003590 ENSNLEP00000003590 XP_003265508.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]