SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003628 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003628
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-34
Family C-type lectin domain 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003628   Gene: ENSNLEG00000002968   Transcript: ENSNLET00000003806
Sequence length 199
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1417647:1426701:-1 gene:ENSNLEG00000002968 transcript:ENSNLET00000003806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSENCFVAENSALHPESGQENDATSPHFSARHEGSFKVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSTCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDYEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNITGSEKCVFLKNTE
VSSMECEKNLYWICNKPYK
Download sequence
Identical sequences G1QRR0
XP_003265512.1.23891 ENSNLEP00000003628 ENSNLEP00000003628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]