SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003677 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003677
Domain Number 1 Region: 108-230
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-32
Family C-type lectin domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003677   Gene: ENSNLEG00000003000   Transcript: ENSNLET00000003860
Sequence length 230
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1484912:1502179:1 gene:ENSNLEG00000003000 transcript:ENSNLET00000003860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVMLHWYKILLGISGTVNGILALTLVSLIL
LVSQGVLLKCQKGSYSNTTEYEDIGDLKVNNGTRRNISNKDLCVSRSADQTVLCQSEWLK
YQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQSNYVWIGLNFTSL
KMTWTWVDGSPIDSKIFFNKGTSENTWAALKESKIYSETCSSVFKWICQY
Download sequence
Identical sequences ENSNLEP00000003677 ENSNLEP00000003677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]