SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003681 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003681
Domain Number 1 Region: 120-235
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-22
Family Cadherin 0.00031
Further Details:      
 
Domain Number 2 Region: 556-670
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 3 Region: 334-441
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 442-559
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000133
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 245-340
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 34-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000443
Family Cadherin 0.0038
Further Details:      
 
Domain Number 7 Region: 660-764
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000214
Family Cadherin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003681   Gene: ENSNLEG00000002974   Transcript: ENSNLET00000003864
Sequence length 832
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:8389718:8475102:-1 gene:ENSNLEG00000002974 transcript:ENSNLET00000003864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILQTHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFMIEREGLLYYTRALDRETRSTHNLQVAALDANGTIVEGPVPITIEVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APEPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDREGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTVNSFLNYIIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTSVGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFQAENPEPLV
FGVMYNTSSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDIRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILTDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQSDWEVSK
INGTHARLSTRHTDFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGMLLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS
Download sequence
Identical sequences A0A2I3HZ80
ENSNLEP00000003681 XP_003268361.1.23891 XP_003268363.1.23891 XP_012351487.1.23891 ENSNLEP00000003681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]