SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003712 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003712
Domain Number 1 Region: 78-196
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-31
Family C-type lectin domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003712   Gene: ENSNLEG00000003058   Transcript: ENSNLET00000003897
Sequence length 207
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1544943:1561349:1 gene:ENSNLEG00000003058 transcript:ENSNLET00000003897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENEDGYMMLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIGILIFIITVIDLKFWQKKM
DFSQNVNISSLSGHNYLCPNDWLLNKGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLD
ELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGKWV
YSEDCSSTFKGICQRDAILTHNRTSGV
Download sequence
Identical sequences G1QRZ4
XP_003265516.1.23891 ENSNLEP00000003712 ENSNLEP00000003712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]