SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003719 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003719
Domain Number 1 Region: 626-825
Classification Level Classification E-value
Superfamily Fibronectin type III 3.1e-33
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 2 Region: 828-1022
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-32
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 256-353
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.0091
Further Details:      
 
Domain Number 4 Region: 340-435
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-17
Family I set domains 0.0099
Further Details:      
 
Domain Number 5 Region: 442-529
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 6 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000426
Family I set domains 0.0095
Further Details:      
 
Domain Number 7 Region: 539-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000541
Family I set domains 0.023
Further Details:      
 
Domain Number 8 Region: 138-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000207
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003719   Gene: ENSNLEG00000002952   Transcript: ENSNLET00000003904
Sequence length 1225
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:7532400:7765830:1 gene:ENSNLEG00000002952 transcript:ENSNLET00000003904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLLPGRGLIISLIFFLLKFSTAIEIPPSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFTWTKDGNPFYFTDHRIITSNDSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERV
YMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIG
SKANSIKQRKPKLLLPPTESGSESSITILKGETLLLECFAEGLPTPQVDWNKIGGDLPKG
RETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYST
GSNGILLCEAEGEPQPTIKWRVNGSPIDNHPFAGDVVFPREISFTNLQPNHTAVYQCEAS
NVHGTILANANIDVVDVRPLIQTKDGENYATVVGYNAFLHCEFFASPEAVVSWQKVEEVK
PLEGRQYHIYENGTLQINRTTEDDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNP
RIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLE
DQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRLTWEAGADHNSNISE
YIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDHH
ETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEET
VTNHTLRVMTPAVYAPYDVKVQAINQLGSGPEPQSVTLYSGEDYPDTAPVIHGVDVINST
LVKVTWSTIPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDA
FSEFHLTVLAYNSKGAGPESEPYVFQTPEGVPERPTFLKVIKVDKDTATLSWGLPKKLNG
NLTGYLLQYQIINDTYEIGELNNINITTPSKPSWHLSNLSATTKYKFYLRACTSQGCGKP
ITEESSTLGEGSKGIGKISEGVNLTQKTHPIEVFEPGAEHIVRLMTKNWGDNDSIFQDVI
ETRGREYAGLYDDISTQGWFIGLMCAIALLTLVLLTVCFVKRNRGGKYSVKEKEDLHPDP
EIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFNEDGSFIG
AYAGSKEKGSVESNGSSTATFPLRA
Download sequence
Identical sequences G1QS01
ENSNLEP00000003719 XP_012357698.1.23891 ENSNLEP00000003719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]