SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003735 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000003735
Domain Number - Region: 128-179
Classification Level Classification E-value
Superfamily L domain-like 0.000349
Family Ngr ectodomain-like 0.035
Further Details:      
 
Domain Number - Region: 214-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003735   Gene: ENSNLEG00000003022   Transcript: ENSNLET00000003921
Sequence length 283
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:6492019:6496976:1 gene:ENSNLEG00000003022 transcript:ENSNLET00000003921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KISAEAPRAGKPPSSPTATGPGRLGHARGRGPDALRGGAAGPGRASSGAPRERKMAPHGP
GSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVALYCKTTRELMLHARCCL
NQKGTILGLDLQNCSLEDPGPNFHQALTTVIIDLQANPLKGDLANTFHGFTHLQTLILPQ
DVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADG
FHGYKCMRQGSFSLLMFFGILGSTTLSISILLWGTQRRKAKTS
Download sequence
Identical sequences ENSNLEP00000003735 ENSNLEP00000003735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]