SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003738 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003738
Domain Number 1 Region: 838-932
Classification Level Classification E-value
Superfamily Fibronectin type III 8.48e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 123-220
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000126
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003738   Gene: ENSNLEG00000002937   Transcript: ENSNLET00000003924
Sequence length 1075
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:7094580:7341915:-1 gene:ENSNLEG00000002937 transcript:ENSNLET00000003924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPN
VKLEGLLLGYGSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTR
SRKPLQLVVGTLTPSSVFLSWGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQI
CPATETIVENLKPNTVYEFGVKDNVEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVP
AYVPRKLIPITIIKQVIQNVTHKDSTKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMF
EISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETT
LASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISESYTATSDRILDSVPP
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPR
TKPERTTSAGTITPKISKSPEPTWTTPAPSKTQFISLKPKIPLSSEVTHTKPAPKQTPRA
PPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPDPEVSQS
EPAPLETRGIPFIPMISPSPSREELQTTLEETDQSTQEPFTTKIPRTTELAKTTQAPHRF
YTTMRPRTSDKPHIRPGVKQAPRPSGVGRNVSVDSTHPTKKPGTLRPPLPPRPTPPRRKP
LPPNNVTGKPGSAGIISSGPITIPPLRSTLRPTGTPLERIATDIKQPTVPASGEELENIT
DFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVEN
LKPNTSYEFQVKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYS
ECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFL
DGRTGQQLTSDQLPIKEGYFRAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences G1QS20
ENSNLEP00000003738 ENSNLEP00000003738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]