SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003745 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003745
Domain Number 1 Region: 119-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003745   Gene: ENSNLEG00000003066   Transcript: ENSNLET00000003931
Sequence length 400
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:2974191:3123126:-1 gene:ENSNLEG00000003066 transcript:ENSNLET00000003931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQPAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Download sequence
Identical sequences G1QS27
XP_003256313.1.23891 ENSNLEP00000003745 ENSNLEP00000003745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]