SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003753 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003753
Domain Number 1 Region: 31-122
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000133
Family Fibronectin type III 0.0077
Further Details:      
 
Domain Number 2 Region: 129-226
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000373
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003753   Gene: ENSNLEG00000003102   Transcript: ENSNLET00000003939
Sequence length 232
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:4021476:4029374:1 gene:ENSNLEG00000003102 transcript:ENSNLET00000003939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQLLLALVLWAGCPPCSGRKGPPAALTLPRVQCRAPRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPASTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FIAEHISDPPWPPQSVLPTAATRGRLRAPESGPSLCLQPSMAPTCLGYWIRYKRQGAARF
HQVGPIEATSFILKAVRPRARYYVQVAAQDLTDYGELSDWSLPVTAVMSLGK
Download sequence
Identical sequences ENSNLEP00000003753 ENSNLEP00000003753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]