SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003761 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003761
Domain Number 1 Region: 589-795
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-31
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 798-983
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-25
Family Fibronectin type III 0.0000226
Further Details:      
 
Domain Number 3 Region: 307-400
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-20
Family I set domains 0.00085
Further Details:      
 
Domain Number 4 Region: 494-595
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-17
Family I set domains 0.057
Further Details:      
 
Domain Number 5 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-17
Family I set domains 0.0016
Further Details:      
 
Domain Number 6 Region: 118-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000619
Family I set domains 0.00042
Further Details:      
 
Domain Number 7 Region: 21-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000103
Family I set domains 0.0021
Further Details:      
 
Domain Number 8 Region: 450-499
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000527
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003761   Gene: ENSNLEG00000003079   Transcript: ENSNLET00000003947
Sequence length 1021
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:8421929:8785124:1 gene:ENSNLEG00000003079 transcript:ENSNLET00000003947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNALISPGGLQRCDGLLSRPIFTQEPHDVIFPLDLSQSEVILNCAANGYPSPHYRWKQN
GTDIDFTMSYHYRLDGGSLAISSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAYIEDFE
TKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGNLYIAK
VEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAAKDSSV
KLECFALGNPVPDISWRRLDGSSLPGKVKYSKSQAILEIPNFQQEDEGSYECIASNLRGR
NLAKGQLIFYAPPEWEQKIQNTYLSIYDNLLWECKASGKPNPWYTWLKNGERLNPEERIQ
IENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLGKSFIYNQQIQNDILTSCFYK
IQGVNYYSAWAMHWGLRKKPTTLLLLMIIFLLEDGSLKIHNVTRSDAGSYTCIATNQFGT
AKNTGSLIVKERTVITVPPSKMDVTVGESIVLPCQASHDPSIDVVFVWFFNGDVIDLKKG
VAHFERIGGESVGDLMIRNIQLNHSGKYLCTVQTTLESLSAVADIIVRGPPGPPEDVKVE
DISSTTSQLSWRAGPDNNSPIQIFAIQTRTPFSVGWQAVATVPEILNGKTYSATVVGLSP
WVEYEFRVVAGNSIGIGEPSKPSELLRTKASVPVVAPVNINGGGGSRSELVITWESIPEE
LQNGEGFGYIIMFRPVGSTTWSKEKVASVESSRFVYRNESIIPLSPFEVKVGVYNNEGEG
SLSTVTIVYSGEDEPQLAPRGTSVQSFSASEMEVSWNAIAWNRNTGRVLGYEVLYWTDDS
KESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKKSPPSQPP
ANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHVLETNNTSAELLVPFE
EDYLIEIRTVSDGGDGSSSEEIRIPRMSSLSSRGIQVLEPSTHFLSIVIVIFYCFAIQPL
I
Download sequence
Identical sequences ENSNLEP00000003761 ENSNLEP00000003761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]