SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003819 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003819
Domain Number 1 Region: 429-660
Classification Level Classification E-value
Superfamily GFP-like 2.51e-91
Family Domain G2 of nidogen-1 0.00000000142
Further Details:      
 
Domain Number 2 Region: 943-1179
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-47
Family YWTD domain 0.000000000792
Further Details:      
 
Domain Number 3 Region: 811-919
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-25
Family Thyroglobulin type-1 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 385-426,671-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 762-841,877-890,1200-1244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-16
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003819   Gene: ENSNLEG00000003070   Transcript: ENSNLET00000004011
Sequence length 1247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:5507322:5599127:-1 gene:ENSNLEG00000003070 transcript:ENSNLET00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSSRIRAAWTRALLLPLLLAGPGGCLSRQELFPFGPGQGDLELEDGDDLVSPALELS
GALRFYDRSDIDSVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQEGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENKQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESIENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQTPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGHLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRVYTYQWRQTITFQECIHDDSRPALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHAICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRARCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGAADPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGSQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKVLEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences G1QSA1
ENSNLEP00000003819 XP_003267344.1.23891 ENSNLEP00000003819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]