SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003830 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003830
Domain Number 1 Region: 92-263
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-32
Family C-type lectin domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003830   Gene: ENSNLEG00000003121   Transcript: ENSNLET00000004023
Sequence length 280
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1699460:1728916:-1 gene:ENSNLEG00000003121 transcript:ENSNLET00000004023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAKYSSTKDMLDDDGDTTMSLHSQASATTRRPEPRRTEHRAPSSTWRPVALTLLTLCLV
LLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNMSRELQSLQVQNIKLAGSLQHVAEK
LCRELYNKARAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQED
LDFAVSESYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAIL
NGMIFSKDCQELKRCVCERRAGMVKPESLHFPPETLGEGD
Download sequence
Identical sequences A0A2I3HRT0
ENSNLEP00000003830 XP_012357766.1.23891 ENSNLEP00000003830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]