SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003849 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003849
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 1.44e-83
Family Caspase catalytic domain 0.000000000175
Further Details:      
 
Domain Number 2 Region: 32-121
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-22
Family Caspase recruitment domain, CARD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003849   Gene: ENSNLEG00000003156   Transcript: ENSNLET00000004042
Sequence length 452
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:3629748:3650370:1 gene:ENSNLEG00000003156 transcript:ENSNLET00000004042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSAGSWSTFQHKELMAADRGRRMLGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDVLLT
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLHKKLRLSTDTVEHSLDNKDGPVCLQVKPCI
PEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHNTLVTLFKLLGYDV
HVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPT
RSDMICGYACLRGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Download sequence
Identical sequences G1QSD1
ENSNLEP00000003849 XP_003270903.1.23891 ENSNLEP00000003849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]