SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003850 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003850
Domain Number 1 Region: 222-289
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-20
Family RING finger domain, C3HC4 0.0038
Further Details:      
 
Domain Number 2 Region: 94-135
Classification Level Classification E-value
Superfamily PA domain 0.00000876
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003850   Gene: ENSNLEG00000003149   Transcript: ENSNLET00000004043
Sequence length 381
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:3301685:3475413:1 gene:ENSNLEG00000003149 transcript:ENSNLET00000004043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLP
AEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAI
VHNVDSDDLISMGSNDIEVLKKIDIPSVFIGESSANSLKDEFTYEKGGHLILVPEFSLPL
EYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVC
AICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQ
EENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINE
HDVVVQLQPNGERDYNIANTV
Download sequence
Identical sequences A0A2J8WSU8 A0A2K5JDK3 A0A2K6MC50 A0A2K6PK86 G1QSD2 G3QW07 H2QNK4 O43567 Q5RCV8
ENSPTRP00000026721 gi|34577087|ref|NP_899237.1| gi|6005864|ref|NP_009213.1| NP_001125196.1.23681 NP_009213.1.87134 NP_009213.1.92137 NP_899237.1.87134 NP_899237.1.92137 XP_001142115.1.37143 XP_003256319.1.23891 XP_003256320.1.23891 XP_003826520.1.60992 XP_004037884.1.27298 XP_010355146.1.97406 XP_011510675.1.92137 XP_011510676.1.92137 XP_011814334.1.43180 XP_011814335.1.43180 XP_014199889.1.60992 XP_016797640.1.37143 XP_016861143.1.92137 XP_016861144.1.92137 XP_018879159.1.27298 XP_018879160.1.27298 XP_018879161.1.27298 9598.ENSPTRP00000026721 9606.ENSP00000341361 hsi002013838.1 ENSP00000341361 ENSP00000376628 ENSPTRP00000026721 ENSP00000341361 ENSP00000376628 ENSNLEP00000003850 ENSGGOP00000006948 ENSGGOP00000006948 ENSNLEP00000003850 ENSP00000341361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]