SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003853 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003853
Domain Number 1 Region: 595-801
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-31
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 2 Region: 803-988
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-27
Family Fibronectin type III 0.0000242
Further Details:      
 
Domain Number 3 Region: 416-502
Classification Level Classification E-value
Superfamily Immunoglobulin 7.49e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 315-403
Classification Level Classification E-value
Superfamily Immunoglobulin 9.49e-21
Family I set domains 0.00095
Further Details:      
 
Domain Number 5 Region: 224-310
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-20
Family I set domains 0.0026
Further Details:      
 
Domain Number 6 Region: 497-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-17
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 24-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-17
Family I set domains 0.00036
Further Details:      
 
Domain Number 8 Region: 124-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000577
Family I set domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003853   Gene: ENSNLEG00000003113   Transcript: ENSNLET00000004046
Sequence length 1026
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:9985270:10498785:1 gene:ENSNLEG00000003113 transcript:ENSNLET00000004046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPWELLVLQSFMLCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHI
RWKLNGTDVDTGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAY
LDNFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKG
ATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGILEIPNFQQEDAGLYECVAENS
RGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYRWLKNGEHLQTRD
RIQIEQGTLNITMVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK
VGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCVAT
NHFGTASSTGNLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLI
DFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVF
NNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKY
WRHEDKEENARKIRTVGNQTSTKITNLKGSALYHLAVKAYNSAGTGPSSAIVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISL
TARSSL
Download sequence
Identical sequences A0A2I3HVT9
ENSNLEP00000003853 XP_003264959.1.23891 ENSNLEP00000003853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]