SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003859 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003859
Domain Number 1 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-20
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 2 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000439
Family C2 set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003859   Gene: ENSNLEG00000026874   Transcript: ENSNLET00000004052
Sequence length 334
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17467745:17478372:1 gene:ENSNLEG00000026874 transcript:ENSNLET00000004052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSAGWYPQPQIQWS
DAKGENIPAVEAPVVADRVGLYAVAASVIMRGGSGEGVSCIIRNSLLSLEKTASISIADP
FFRSAQPWITALAGTLPILLLLLAGASYFLWRQQKEITALSSEIESEQEMKEMGYAAAEQ
EISLRESLQEELKRKKVQYLTRGEESSSDTNKSA
Download sequence
Identical sequences ENSNLEP00000003859 XP_012364504.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]