SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003860 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003860
Domain Number 1 Region: 105-245
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-35
Family C-type lectin domain 0.0000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003860   Gene: ENSNLEG00000003175   Transcript: ENSNLET00000004053
Sequence length 247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1738870:1750660:-1 gene:ENSNLEG00000003175 transcript:ENSNLET00000004053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYHPDLENLDEDGYTQLHFNSQSNTRIAVVSEKGSCAASLPWRLIAVILGILCLVILVI
AVVLGTVAIWRSNSGSNTLENGYFPSRNKENHSQPTQASLEESVTPTKAVKTTGVLSSPC
PPNWMIYEKSCYLFSMSLNSWDGSKRQCSQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATNENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM
Download sequence
Identical sequences A0A2I3GVU0
ENSNLEP00000003860 XP_003265524.1.23891 XP_012357783.1.23891 ENSNLEP00000003860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]