SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003900 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003900
Domain Number 1 Region: 128-227
Classification Level Classification E-value
Superfamily Fibronectin type III 2.47e-17
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 2 Region: 241-333
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000556
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003900
Domain Number - Region: 32-83
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0209
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003900   Gene: ENSNLEG00000003193   Transcript: ENSNLET00000004093
Sequence length 422
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:10508331:10553294:-1 gene:ENSNLEG00000003193 transcript:ENSNLET00000004093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMIIMAPVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLHWKPNPDQEQ
RNANPEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWVSAEL
HAPPGSPGTSIVNLTCTTNTTADNYSHLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSW
TEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQ
INPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKMMTNAFISII
DDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFLVVLMATVCFILLIL
SLICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDS
VF
Download sequence
Identical sequences ENSNLEP00000003900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]