SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003902 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003902
Domain Number 1 Region: 398-509
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 694-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 754-826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000473
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 338-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 820-880
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 514-573
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 7 Region: 223-339
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000366
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 8 Region: 611-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000288
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003902   Gene: ENSNLEG00000003213   Transcript: ENSNLET00000004095
Sequence length 978
Comment pep:known_by_projection supercontig:Nleu1.0:GL397407.1:1842624:1869264:-1 gene:ENSNLEG00000003213 transcript:ENSNLET00000004095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSLEAPTVGKGQAPGIEETDGELTAAPTPEQPERGVHFVTTAPTLKLLNHHPLLEEFLQ
EGLEKGDEELRPALPFQPDPPTPFTPSPLPRLANQDSRPVFTSPTPAMAAVPTQPQSKEG
PWSPESESPMLRITAPLPPGPSMAVPTLGPGERASTTPPSRAWTPTQEGPGDMGRPWVPE
VVSQGAGIGIQGTITSSTASGDDEETTTTTTIITTTITTVQTPGPCSWNFSGPEGSLDSP
TDLSSPTDVGLDCFFYISVYPGYGVEIKVQNISLREGETVTVEGLGGPDPLPLANQSFLL
RGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPRRPAYGDVTVTSLHPGGS
ARFHCATGYQLKGARRLTCLNATQPFWDSKEPVCIAACGGVIRNATTGRIVSPGFPGNYS
NNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLPIEGL
LSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPTYPVGTTVEFS
CDPGYTLEQGSIIIECVDPHDPQWNETEPACRGQDTQWMGLPGKKQAPMWWNSTPEVWGY
PVSSPSSGPQAGSALMLLLHRLRIGPGDVLTFYDGDDLTARVLGQYSGPRSHFKLFTSMA
DVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGTVVTY
QCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVGATVQ
YICDQGFVLTGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGAQSPQKRLH
PAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYNSRSLDVAKAPA
ASGTLDAAHIAAAIFLPLVAMVLLVGGVYFYFSRLQGKSSLQLPRTRPRPYNRITIESAF
DNPTYETGSLSFAGDERI
Download sequence
Identical sequences ENSNLEP00000003902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]