SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003903 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003903
Domain Number 1 Region: 332-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-67
Family SPRY domain 0.00000985
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000487
Family C2 set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003903   Gene: ENSNLEG00000003166   Transcript: ENSNLET00000004096
Sequence length 583
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17524972:17537911:1 gene:ENSNLEG00000003166 transcript:ENSNLET00000004096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHVEVKGYEDGGIHLECRSTGWYPQPQIKWS
NTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADP
FFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATER
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK
GWVKMSPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEVSFYNATDG
SHIYTFPHTSFSEPLYPVFRILTLEPTALTICPIPKVERSPNPDLVPDHSLETPVTPDLA
NESGEPQAEVTSLLLPAHPGAEVSPSATTNQNHKLQEHTEALY
Download sequence
Identical sequences G1QSI5
ENSNLEP00000003903 ENSNLEP00000003903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]