SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003914 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003914
Domain Number 1 Region: 769-879
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000222
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 2 Region: 1080-1189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000106
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 961-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000273
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003914   Gene: ENSNLEG00000003187   Transcript: ENSNLET00000004108
Sequence length 2319
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:8843599:9350074:1 gene:ENSNLEG00000003187 transcript:ENSNLET00000004108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMSVTLSPLRSQDLDPMATDASPMAINMTPTVEQGEGEEAMKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLSGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVAADSISTNGSEAVTEEVSQVSLS
VDDKGGYEEGNASAVEEQPGLTPGVSSSSGEALTNAVQPSSETVKQESSSSSHLDVKNQQ
PVPCENATPKRTIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNDLKGNGGKKQMVDLNPE
MSRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGDGNLENTVKFHIKEISS
SLGRLNDCYKEKSQLKKPHKTSEEVPPCRTPKRGTGSGKQAKNTRSSGVPNGELSCTSKA
IEGPQTNSASTSSREPCNQRSWDAKLQLQSETSSSPPFTQSSESSVGSDNIMSPVPLLSK
HKSKKGHASSPSHVTRNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRG
ETIQNIDDWELSEMNSDSEIYPTYHVKKKHTSLGRVSPSSSSDIASSLGESIESGPLSDI
LSDEESSIPLTGMKKYADEKSERPSSSEKNESHSATKSALIQKLMQDIQHQDNYEAIWEK
IEGFVNKLDEFIHWLNEAMETTENWTPPKAEMDGLKLYLETHLSFKLNVDSHCALKEAVE
EEGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSV
EDEEGTGSPKAEVQLCYLEAQSDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGSNG
LLDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKV
EALKKGGVLLPNDLLEKVDSINEKWELLGKTLGEKIQDTMAGHSGSSPRDLLSPESGSLV
RQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNTEKQLQYFKSLCREIKQRRRGVASI
LRLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESETLN
VIDPGLMDLNGMSEDALEWDEMDISNKLISLNEESNDLDQEPQPVISSLKLGETSNEDPG
YDEEGDNHGGSQYASNITAPSSPHIYQVYSLHNVELYEDNHMPFLKNNPKVTGMTQPNVL
TKSLSKDSSFSSTKSLPDLLGGSNLVKPCACHGGDMSQNSGSESGIVSEGDTETTTNSEM
CLLNAVDGSPSNLETEHLDPQMGDAVNVLKQKFKDEGECIKLPNSSQSSISPVGCVNGKV
GDLNSVTKHTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLR
GFYFDKKSCKSKHQTTELQPDVPPHERILASASHEMDRISYKSGNIEKTFTGMQNTKQLS
LLSHSSSIESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISV
SSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQAVPKKMSFTGQMSLDIASSI
NEDSAASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNV
SCTSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEDCNLMSGLDYIKN
ELQTWIRPKLSLTRDKKRCNVSDEMKGSKDVSSSEMTNPSDTLNIETLLNGSVKRVSENN
GNGKNSSHTRELGTKGENKKTIFKVNKDPYVADMENGNIEGIPERQKDKLNGTSKVSENL
GSNGEEISESEHCKCKALMDSLDDSNTAGKEFVSQDVRHLPKKCPNHHHFENQSTASTPT
EKSFSELALETRFNNRQDSDAMKSSDDAPSMAGKSAGCCLALEQNGTEENASISNISCCN
CEPDVFHQKDAEDCSVHNFVKEIIDMASTALKSKSQPENEVAAPTSLTQIKEKVLEHSHR
PIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPLDTTDSGLDDKEDIECFFEACV
EGDADGEEPCFSSVPPNESAVPSEAAMPLQATACSSDFSDSSLLADDADTVALSSPSSQE
RAEDGKEVNGLPQTSSGCAENVEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDL
SLKANQPTDKAALHPSPKTSTCEENLLNLHEERHRNMHR
Download sequence
Identical sequences XP_012359958.1.23891 ENSNLEP00000003914 ENSNLEP00000003914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]