SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003928 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003928
Domain Number 1 Region: 128-205
Classification Level Classification E-value
Superfamily DEATH domain 0.000000353
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003928   Gene: ENSNLEG00000003225   Transcript: ENSNLET00000004122
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:5898184:5988895:1 gene:ENSNLEG00000003225 transcript:ENSNLET00000004122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRTTKQMGRGTKAPGHQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEESDTI
TLNCPRNSDMKNQGEENGFPDSTGDPLPEIRKDNSCKENCTCSSCLLRAPTISDLLNDQD
LLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLM
ELCRLYHRADVEKVLRRWVDEEWPKREGGDPSRHF
Download sequence
Identical sequences G1QSL0
ENSNLEP00000003928 XP_003267348.1.23891 ENSNLEP00000003928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]