SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003936 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003936
Domain Number 1 Region: 319-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-66
Family SPRY domain 0.00000466
Further Details:      
 
Domain Number 2 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.65e-22
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 
Domain Number 3 Region: 160-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000188
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003936   Gene: ENSNLEG00000003228   Transcript: ENSNLET00000004131
Sequence length 523
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17485510:17495544:1 gene:ENSNLEG00000003228 transcript:ENSNLET00000004131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAALHFSLPASLLLLLLLLLLRLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPE
KNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDIIKGSVALVIHNVT
TQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISTGWYPEPLT
VWRDPYGEVVPTLKEVSIADADGLFMVTTAVIIRDKYVRNVSCSINNTLLGQEKETVIFI
PESFMPSTSPWMVALAVILTASPWMVPMAVILAVCIIFMAMSICCIKKLQREKKILSGEK
EVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPETAHPELFLSEDRRSVRRGPCRQRVPD
NPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL
EMFGNQYRALSSPERVLPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPV
RPFFRLGSDDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences A0A2I3HA41
XP_003263334.1.23891 XP_012364503.1.23891 ENSNLEP00000003936 ENSNLEP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]