SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003968 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003968
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-32
Family C-type lectin domain 0.000000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003968   Gene: ENSNLEG00000003274   Transcript: ENSNLET00000004165
Sequence length 180
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1930230:1936692:1 gene:ENSNLEG00000003274 transcript:ENSNLET00000004165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPKIELQKDSDCCS
CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELQDFMSSSQQFYWIGL
SYSEEHTAWLWENGSALSQYLFPLLETFNPKNCIAYNPNGNALDEPCEDKNRYICKQQLI
Download sequence
Identical sequences ENSNLEP00000003968 XP_012357795.1.23891 ENSNLEP00000003968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]