SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003992 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003992
Domain Number 1 Region: 1241-1601
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.81e-123
Family Hect, E3 ligase catalytic domain 0.00000000972
Further Details:      
 
Domain Number 2 Region: 827-863
Classification Level Classification E-value
Superfamily WW domain 0.00000000000475
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 213-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000637
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 4 Region: 1011-1053
Classification Level Classification E-value
Superfamily WW domain 0.000000000145
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003992   Gene: ENSNLEG00000003209   Transcript: ENSNLET00000004189
Sequence length 1607
Comment pep:known_by_projection supercontig:Nleu1.0:GL397320.1:7934362:8408038:1 gene:ENSNLEG00000003209 transcript:ENSNLET00000004189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLHLCSVKNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDG
VTIPRSTSDTDLVTSDSRSTLTVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEV
LSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVK
NSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSI
FPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGK
LSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISLSTEPE
SAQIQDSPMNNLMESGSGEPRSEAAESSESWKPEQLGEGSVPDGPGNQSMELSRPAEEAA
VITEAGDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDSEVPA
STEEEPLEEEATTQSRAGREKEEKEQEEEEGDVSTLEQGVGRLQLRASVKRKSRPCSLPV
SELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGVSAAEEEDGAEEESTLKDSSEKDG
LSEVDTVTADPSALEQDREEPEGATPGTAHPGHSGGHFPSLANGTAQDGDTHPSTGSESD
SSPRQGGDHSCEGCDASCCSPSCYSSSCYSTSCYSSSCYSASCYSPSCYNGNRFASHTRF
SSVDSAKISESTVFSSQDDEEEENSAFESVPDSMQSPELDPESTNGAGPWQDELAAPSGH
VERTPEGLESPVAGPSNRREGECPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARI
DSHGRVFYVDHVNRTTTWQRPTAAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEE
DSGSQSCEQAPAGGGGGGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFIT
NPEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLE
LPRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEA
SEVSRNRGASLLARPGHSLVAAIRSQHQNESLPLAYNDKIVAFLRQPNIFEMLQERQPSL
ARNHTLREKIHYIRTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQAAFHPGYSFSPR
CSPCSSPQNSPGLQRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHL
LEGTFNQVMAYSRKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSA
NDTYTVQISPMSAFVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSD
LEYLDEEFHQSLQWMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEY
IERMVKWRVERGVVQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNT
EYRGGYHDGHLVIRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCI
EKWGKITSLPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences G1QSS4
ENSNLEP00000003992 ENSNLEP00000003992 XP_003268871.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]