SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003994 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003994
Domain Number 1 Region: 6-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-27
Family Gluconate kinase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003994   Gene: ENSNLEG00000003292   Transcript: ENSNLET00000004191
Sequence length 187
Comment pep:known_by_projection supercontig:Nleu1.0:GL397309.1:15049183:15072538:1 gene:ENSNLEG00000003292 transcript:ENSNLET00000004191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGAVLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIP
WLCNLHDILLRDVASGQHVVLACSALKKMYRDILTQGKDGVALKCEESGKEAKQAEMQLL
VVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPEAPENFIQISVDKNVSEIIATI
METLKMK
Download sequence
Identical sequences A0A2I3GKW0
ENSNLEP00000003994 XP_003267500.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]