SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004023 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004023
Domain Number 1 Region: 34-391
Classification Level Classification E-value
Superfamily L domain-like 6.12e-61
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 428-516
Classification Level Classification E-value
Superfamily Immunoglobulin 7.45e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 527-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000039
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004023   Gene: ENSNLEG00000003325   Transcript: ENSNLET00000004220
Sequence length 716
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:11288571:11337447:1 gene:ENSNLEG00000003325 transcript:ENSNLET00000004220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMSFVVAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISANAFAGLKNLLRLHLNSNRLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLVNLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDTFPNRLNMDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSS
EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSIL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW
Download sequence
Identical sequences G1QSV5
ENSNLEP00000004023 ENSNLEP00000004023 XP_003264965.1.23891 XP_004091813.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]