SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004043 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004043
Domain Number 1 Region: 324-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-63
Family SPRY domain 0.00000695
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily Immunoglobulin 8.92e-22
Family V set domains (antibody variable domain-like) 0.00029
Further Details:      
 
Domain Number 3 Region: 159-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000019
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004043   Gene: ENSNLEG00000003305   Transcript: ENSNLET00000004241
Sequence length 531
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17542484:17554183:1 gene:ENSNLEG00000003305 transcript:ENSNLET00000004241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAALHFSRPASLLLLLLLLFSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEK
NAEDMEVRWFRSQFSPAVFVYKGGRQRTEEQMEEYRGKTTFVSKDIRRGSVALVIHNITA
QENGTYRCYFQEGRSSDEAILHLVVAGLGSKPHVEMRGHEDGGIRLECTSGGWYPKPLTV
WRDPYGGGVVPALKEVSMPDTDGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFI
PESFMPSVSPWAVALAIIVVILMILIAICIYWINKLQKEKKILSGEKEFEQETREIAVKE
LEKERVQKQEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFR
HLGESMPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLI
PQNGFWTLEMHKGQYRAMSSPDRILPLKESLCRVGVFLDYEAGDVSFYDMKDRSHIYTCP
RSAFSMPVRPFFRLGCEDNPIFICPALAGANGVTVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences G1QSX5
XP_003263338.1.23891 ENSNLEP00000004043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]