SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004064 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004064
Domain Number 1 Region: 625-917
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-75
Family Protein kinases, catalytic subunit 0.0000000645
Further Details:      
 
Domain Number 2 Region: 27-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-55
Family Ephrin receptor ligand binding domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 3.12e-24
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 907-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.69e-20
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 261-334,370-392
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000106
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004064   Gene: ENSNLEG00000003297   Transcript: ENSNLET00000004262
Sequence length 975
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:3727488:3745398:-1 gene:ENSNLEG00000003297 transcript:ENSNLET00000004262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRWPLGLGLVLLLCAPLPPGARTKEVTLMDTSKAQGELGWLLDPPKDGWSERQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSMKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEECIACPSGSYRTDMDTPHCLTCPQH
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLHWEPPADTGG
RQDVRYNVRCSQCQGTAQDGGPCQPCGVGVHFSPGVRGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPQSPGANLS
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAIIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRTTDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLYDFDGT
YETQGGKIPIRTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIED
GYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRVT
LRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLP
GHQKRILCSIQGFKD
Download sequence
Identical sequences G1QSZ6
ENSNLEP00000004064 ENSNLEP00000004064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]