SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004093 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004093
Domain Number 1 Region: 89-368
Classification Level Classification E-value
Superfamily C-type lectin-like 2.04e-101
Family Sulfatase-modifying factor-like 0.0000000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004093   Gene: ENSNLEG00000003334   Transcript: ENSNLET00000004295
Sequence length 374
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:11837526:11939456:-1 gene:ENSNLEG00000003334 transcript:ENSNLET00000004295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVGLVCRRCPEPGLVLLLLLLSLLCGAVGSEEARTGAGAGSLAGSCGCGTPQRPGA
HGSSAAAHRYSREANAPGPVPGKRQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVA
IDAFYMDAYEVSNAEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWW
LPVKGANWRHPEWPDSTIRHRPDHPVLHVSWNDAFAYCTWAGKRLPTEAEWEYSCRGGLH
NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWE
WTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASN
LGFRCAADCLPTMD
Download sequence
Identical sequences G1QT25
ENSNLEP00000004093 ENSNLEP00000004093 XP_003264966.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]