SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004100 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004100
Domain Number 1 Region: 295-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-72
Family SPRY domain 0.00000385
Further Details:      
 
Domain Number 2 Region: 28-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-22
Family V set domains (antibody variable domain-like) 0.0000924
Further Details:      
 
Domain Number 3 Region: 151-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000566
Family C1 set domains (antibody constant domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004100   Gene: ENSNLEG00000003349   Transcript: ENSNLET00000004303
Sequence length 526
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17585215:17594374:1 gene:ENSNLEG00000003349 transcript:ENSNLET00000004303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFASSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILSIVGEDAELPCRLSPNASAEH
LELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDG
EYTCFIREDGSYEEALVHLKVAALGSDPYISMQVQENGEIRLECTSVGWYPEPQVQWRSS
KGEKFPSTSESRNPDEEGLFTVAASVTIRDTSAKNVSCYIQNLLLGQEKEVEISIPASSL
PRLTPWIVAVAVILMALGFLTIGSIFFSWRLYNERSRERRNEFSSKERLLEELKWKKATL
HAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKPERFDSWPCVLGHETFTSGRHYW
EVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPH
RVGIFLDYESGDISFYNMNDGSNIYTFSNVSFSGPLRPFFCLWSSGKKPLTICPIAEGPE
GVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP
Download sequence
Identical sequences G1QT32
ENSNLEP00000004100 XP_003263346.1.23891 ENSNLEP00000004100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]