SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004120 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004120
Domain Number 1 Region: 68-179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-39
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 183-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-36
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 302-408
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004120   Gene: ENSNLEG00000003398   Transcript: ENSNLET00000004328
Sequence length 485
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:7269298:7285620:1 gene:ENSNLEG00000003398 transcript:ENSNLET00000004328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLTWRPFPPHLSFPCSRPSDPGLPELGRPVGAPGEEMLAERGALLLLAVALLGPGPRA
QAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSVVLLTFHAFDLEYHDT
CSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVVFHSDKHVAGHGFSAGYQK
DVCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGPARVKLVFVDFQVEGNEECTYDY
VAVLGGPGPTRGHHYCGSTMPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYM
AVRGNFSSPQYPSSYPNNIRCHWTIRLPPGYRVKVFFLDLDLEEPNSLTKTCDFDHLAAF
DGASEEAPLLGNWCGHHLPPPVTSSHNQLLLLLHTDRSTTRRGFSVAYIGGQLGCGSGST
EGEGEALQPRSLQPPSSIPPVCPPPMNGLLQRLLRWLHPCPFSGPRLDGTALTCFHYCRA
SFPSS
Download sequence
Identical sequences ENSNLEP00000004120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]