SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004127 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004127
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-18
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 54-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004127   Gene: ENSNLEG00000003391   Transcript: ENSNLET00000004335
Sequence length 170
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:2083994:2119938:-1 gene:ENSNLEG00000003391 transcript:ENSNLET00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILMDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKR
LSSAPSSRAEPIRTTIFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Download sequence
Identical sequences G1QT59
ENSNLEP00000004127 ENSNLEP00000004127 XP_003258106.1.23891 XP_003258107.1.23891 XP_003258108.1.23891 XP_004088545.1.23891 XP_012363407.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]