SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004148 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004148
Domain Number 1 Region: 388-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 324-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 3 Region: 286-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004148
Domain Number - Region: 251-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0548
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004148   Gene: ENSNLEG00000003396   Transcript: ENSNLET00000004359
Sequence length 684
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:1853871:1862415:1 gene:ENSNLEG00000003396 transcript:ENSNLET00000004359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRG
GIHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEA
WHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYG
DNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLC
RPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCS
NSGQRSYTCTCRPGYTGVDCELELSECDSNSCRNGGSCKDQEDGYHCLCPPGYYGLHCEH
STLSCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRG
PSRMCRCRPGFTGTYCERHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSI
DACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAVL
LVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLD
KSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICSP
RDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences ENSNLEP00000004148 ENSNLEP00000004148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]