SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004195 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004195
Domain Number 1 Region: 746-860
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-33
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1438-1551
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1789-1908
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-32
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 4 Region: 1966-2073
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 5 Region: 582-686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 202-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 25-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-28
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 8 Region: 405-515
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 9 Region: 1264-1385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 2360-2464
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2180-2287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 12 Region: 918-1039
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 13 Region: 1097-1206
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 14 Region: 1611-1726
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 15 Region: 3010-3078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.4e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2833-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.33e-17
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 17 Region: 2949-3015
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 2714-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 3129-3197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.67e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 2890-2960
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 342-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 22 Region: 2655-2718
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 23 Region: 2122-2190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 2466-2539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000117
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 25 Region: 1907-1969
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2529-2596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000135
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 27 Region: 2766-2826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 3061-3123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 29 Region: 866-926
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 1384-1447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 138-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 32 Region: 520-582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 33 Region: 1556-1623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000648
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 34 Region: 1209-1272
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000863
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 1039-1101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000031
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 36 Region: 2292-2356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 37 Region: 1733-1796
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 691-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 3188-3247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 40 Region: 2601-2666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004195   Gene: ENSNLEG00000003311   Transcript: ENSNLET00000004413
Sequence length 3486
Comment pep:known_by_projection supercontig:Nleu1.0:GL397394.1:2810090:3477937:-1 gene:ENSNLEG00000003311 transcript:ENSNLET00000004413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLISIAPGPRWQVQSHHPRLAGQNCTFQLHGPNGTVESPGFPYGYPNYANCTWTITAEE
QHRIQLVFQSFALEEDFDVLSVFDGPPQPENLRTRLTGFQLPATIVSAATTLSLHLISDY
AVSAQGFHATYEVLPSHTCGNPGRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCH
ACSENSATWDFPLPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTI
ALVFIDFQLEDGYDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFS
AQYQVKKQIELKSRGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFR
LGSSVQFTCNEGYDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGVITSPN
FPIQYDNNAHCVWIITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTG
TSVPDLIVSTNHQMWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGVPAYGQREGSRFRHG
DTLKFECQPAFELVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGN
HLHCVWLILARPESRIHLAFNDIDVEPQFDFLVIKDGATAEAPILGTFSGNQLPSSITSS
GHVARLEFQTDHSTGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEG
FLGTQGSETITCVLKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAW
VIEAQPGYPIKITFDRFKTEVNYDSLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYL
IFSTDKSHSDIGFQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLS
DGEPLECEPNFQWSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGK
GVFFTFHTFHLESGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDF
SMSYEGFNITFSEYDLEPCEEPEVPAYGIRKGLQFGVGDTLIYSCFPGYRLEGTARITCL
GGRRRLWSSPLPRCVAECGNSVTGTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKA
RAFELSEGDVLKVYDGNNNSARLLGVFSRSEMMEVTLNSTSSSLWLDFITDAENTSKGFE
LQFSSFELIKCEDPGTPQFGYKVHDEGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTW
DRLLPTCVAECGGTVRGEVSGQVLSPGYPAPYEHNLNCIWTIEAEAGCTIGLHFLVFDTE
EVHDVLRIWDGPVESGVLLKELSGPALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVS
TATSCNDPGIPQNGSRSGDSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPT
CIAPCGGDLTGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLH
IYDGRDSLSPLIGSFYGSQPGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDP
GSIKNGTRVGSDLKLGSSVTYYCHGGYEVEGASTLSCILGPDGKPVWNNPRPACTAPCGG
QYVGSDGVVLSPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQH
SRLLSSLSGSHTGESLPLATSNQVLIKFSAKGLAPARGFHFVYQAVPRTSATQCSSVPEP
RYGKRLGSDFSVGAIVRFECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLT
ERRGTILSPGFPEPYLNSLNCVWKIVVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVT
MLGSFSGTTVPALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKT
GERYLVNDVVSFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGAVEEMEGVILS
PGFPGNYPSNVDCSWKIALPVGFGAHIQFLNFSTEPNHDYIEIRNGPYETSRMMGRFSGS
ELPSSLLSTSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFGLSELEGTNSTP
PVAASCVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLTGHPVL
TCQHGTNRNWDHPLPKCEVPCGGNITSSNGTVYSPGFPSPYSSSQDCVWLITVPIGHGVR
LNLSLLQTEPSGDFITIWDGPQQTAPRLGVFTRNMAKKTVHSSSNQVLLKFHRDAAAGGI
FAIAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKLGTY
LQFEGPPPICEVHCPTNELLTGSTGVILSQSYPGSYPQFQTCSWLVRVEPNYNISLTVEY
FLSEKQYDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKI
RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSE
AIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAVYSCSEGYHLQAGAEATAECLDIGLWSN
HNVPPQCVPVTCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQAN
GKWSLGDSTPTCQIISCGELPIPPNGHRIGTLSIYGATAIFSCNSGYTLVGSRVRECMAN
GLWSGSEVRCLAGHCGTPEPIVNGHINGENYSYRGSVVYQCNAGFRLIGMSVRICQQDHH
WSGKTPFCVLVSCGHPGSPPHSQMSGDSFTVGAVVRYSCTGKRTLMGNSTRMCGLDGHWT
GSLPHCSGTSVGVCGDPGIPAHGIRLGDSFDPGSVMRFSCEAGHVLRGSSERTCQANGLW
SGSQPECGVISCGNPGTPSNARVVFSDGLVFSSSIVYECREGYYATGLLSRHCSVNGTWT
GSDPECLVINCGDPGIPANGLRLGNDFRYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWN
GTKPVCKALMCKPPPLIPNGKVVGSDFMWGSSVTYACLEGYQLSLPAVLTCEGNGSWTGE
LPQCFPVFCGDPGVPPRGRREDRGFSYRSSVSFSCHPPLVLVGSPRRFCQSDGTWSGTQP
SCIDPTLTTCADPGVPQFGIQNNSQGYQVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGT
PPDCVPHHCRQPETPTHANVGALDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGK
PPICLEVRPSGKPINPAREPPLTQALIPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQV
ANSKVNATMIDHSGVELHLAGTYKKEDFHLLLQVYQITGPVEIFVNKFKDDHWALDGHVS
SESSGGTFIYQGSVKGQGFGQFGFQRLDLRLLESDPESIGRHFASNSSSVAAAILVPFIA
LIIAGFVLYLYKHRRRPKVPFNGYAGHENTNVRATFENPMYDRNIQPTDIMASEAEFTVS
TVCTAV
Download sequence
Identical sequences ENSNLEP00000004195 ENSNLEP00000004195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]