SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004222 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004222
Domain Number 1 Region: 116-224
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 3 Region: 68-113
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000513
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004222   Gene: ENSNLEG00000003493   Transcript: ENSNLET00000004443
Sequence length 240
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:19384396:19425242:1 gene:ENSNLEG00000003493 transcript:ENSNLET00000004443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPCRPEGCPAHAPCPAPGISTRDECGCCARCLGAEGASCGGRAGARCGPGLVCASRAAGA
APEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVV
VPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGG
PSDHEATAWILINPLQKEDEGLYQCHAANMVGEAESHSTVTVLDLSKYRSFRFPAPDDRM
Download sequence
Identical sequences ENSNLEP00000004222 ENSNLEP00000004222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]