SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004239 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004239
Domain Number 1 Region: 334-392,435-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000136
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 251-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000792
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 31-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000911
Family I set domains 0.082
Further Details:      
 
Domain Number 4 Region: 157-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000578
Family C2 set domains 0.069
Further Details:      
 
Domain Number 5 Region: 385-491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000088
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004239   Gene: ENSNLEG00000003402   Transcript: ENSNLET00000004462
Sequence length 583
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:11710380:11922571:1 gene:ENSNLEG00000003402 transcript:ENSNLET00000004462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIMPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSISNARISDEKRFVCMLVTEDN
VFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPL
EGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSERAVF
DIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKAASKHVNKDLGNMEENKKLEENNHKTEA
Download sequence
Identical sequences A0A2I3HQA2
XP_003261812.1.23891 ENSNLEP00000004239 ENSNLEP00000004239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]