SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004283 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004283
Domain Number 1 Region: 15-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-32
Family Spectrin repeat 0.000000494
Further Details:      
 
Domain Number 4 Region: 635-746
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-22
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 5 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 4.03e-22
Family EF-hand modules in multidomain proteins 0.0016
Further Details:      
 
Domain Number 6 Region: 397-477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000013
Family Spectrin repeat 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004283   Gene: ENSNLEG00000003539   Transcript: ENSNLET00000004507
Sequence length 894
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:6206417:6281662:1 gene:ENSNLEG00000003539 transcript:ENSNLET00000004507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVXXX
XXXXXXXXXXXXXXXXXQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYSIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Download sequence
Identical sequences ENSNLEP00000004283 ENSNLEP00000004283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]