SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004304 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004304
Domain Number 1 Region: 662-853
Classification Level Classification E-value
Superfamily Fibronectin type III 4.79e-41
Family Fibronectin type III 0.00000172
Further Details:      
 
Domain Number 2 Region: 371-564
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-40
Family Fibronectin type III 0.00000243
Further Details:      
 
Domain Number 3 Region: 874-1047
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-37
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 555-658
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-21
Family Fibronectin type III 0.000000649
Further Details:      
 
Domain Number 5 Region: 267-374
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-16
Family Fibronectin type III 0.000000933
Further Details:      
 
Domain Number 6 Region: 1039-1146
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000121
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004304   Gene: ENSNLEG00000003383   Transcript: ENSNLET00000004529
Sequence length 1198
Comment pep:known_by_projection supercontig:Nleu1.0:GL397327.1:9659086:9899380:1 gene:ENSNLEG00000003383 transcript:ENSNLET00000004529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHPPLLDTTQILSSDISLLSAPIVSADGTQQVILVQVNPGEAFTIRREDGQFQCITGP
AQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGGHTVLHRSPHPPLP
GFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSS
KTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQNTGGINTGSAKIKSG
KGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGETDES
TVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPATDYHAKVQAEYNSIKGTPSE
AEIFTTLSCEPDTPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFYQC
YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLTKAGI
TWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKV
IAYNSEGKSNPSEVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGAAINKYV
VEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAV
PPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVEC
TVSSLLPGKTYSFRLHAANKMGFGPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWE
VPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLNYEIKGLSPATTYYCRVQALSVVGAGPF
SEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFG
DKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECV
AFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNESTSYK
FCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIY
SLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTT
VLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFVIK
Download sequence
Identical sequences A0A2I3H648
XP_003270132.1.23891 XP_012362420.1.23891 ENSNLEP00000004304 ENSNLEP00000004304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]