SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004323 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004323
Domain Number - Region: 180-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00262
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0196
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 214-238
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0563
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004323   Gene: ENSNLEG00000003537   Transcript: ENSNLET00000004548
Sequence length 387
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:5879432:6081724:1 gene:ENSNLEG00000003537 transcript:ENSNLET00000004548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSV
APSLATNASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDR
LEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPA
HLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRP
ALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVP
FAATATANQIPIISAEHLTSHKYVTQM
Download sequence
Identical sequences A0A2I3FUN3 A0A2J8WT51 A0A2K5DIE8 A0A2K5JMA5 A0A2K5NSL4 A0A2K5SBP2 A0A2K6A3W3 A0A2K6BT06 A0A2K6KR35 A0A2K6N7Z4 A0A2K6SLW9 F1M9N4 F6UUJ0 F7DHI7 G1LQN0 G7MJH2 G7NZL5
ENSAMEP00000009363 ENSMMUP00000020922 ENSTTRP00000009475 ENSRNOP00000033304 NP_001178495.1.100692 NP_001178495.1.4139 XP_001106579.2.72884 XP_001488787.1.31192 XP_002716341.1.1745 XP_002759528.1.60252 XP_002814240.1.23681 XP_003132542.1.46622 XP_003925070.1.74449 XP_004003289.1.66739 XP_004314972.1.83887 XP_004478872.1.11602 XP_004709085.1.18182 XP_004755631.1.14098 XP_005546193.1.63531 XP_005634636.1.84170 XP_005675483.1.57651 XP_006075692.1.26621 XP_006149809.1.99106 XP_006178062.1.101512 XP_006202878.1.17985 XP_006868030.1.41390 XP_006908282.1.64745 XP_006997892.1.50099 XP_007086351.1.5354 XP_007188212.1.59432 XP_007471994.1.90284 XP_007938342.1.48129 XP_008006865.1.81039 XP_008519476.1.77740 XP_008842930.1.79516 XP_010370390.1.97406 XP_010833701.1.44457 XP_010950305.1.22495 XP_010950306.1.22495 XP_010984933.1.51371 XP_011379144.1.92234 XP_011769710.1.29376 XP_011941473.1.92194 XP_012002573.1.54773 XP_012292437.1.9421 XP_012580319.1.23501 XP_012580320.1.23501 XP_012629846.1.48125 XP_012663282.1.62490 XP_013203999.1.66349 XP_014334489.1.15283 XP_014409058.1.101512 XP_014652083.1.5094 XP_014705054.1.49734 XP_014705055.1.49734 XP_014927977.1.86478 XP_015093473.1.17985 XP_017378365.1.71028 XP_017446156.1.100692 XP_017532703.1.32401 XP_017704316.1.44346 XP_019295452.1.44245 XP_019483027.1.44202 XP_019587565.1.88060 XP_019652080.1.58354 XP_019666107.1.62641 XP_020737745.1.74333 XP_020925306.1.46622 XP_021541608.1.83697 ENSOCUP00000006572 ENSCJAP00000044837 ENSDNOP00000020424 ENSCJAP00000001838 ENSTSYP00000009625 ENSNLEP00000004323 ENSTTRP00000009475 ENSNLEP00000004323 ENSTSYP00000009625 ENSCAFP00000012631 9544.ENSMMUP00000020922 9986.ENSOCUP00000006572 ENSMMUP00000020925 ENSAMEP00000009363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]