SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004372 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004372
Domain Number 1 Region: 1034-1159
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000932
Family GAF domain 0.022
Further Details:      
 
Domain Number 2 Region: 858-942
Classification Level Classification E-value
Superfamily EF-hand 0.0000947
Family Polcalcin 0.074
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004372
Domain Number - Region: 285-360,387-413
Classification Level Classification E-value
Superfamily EF-hand 0.00091
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004372   Gene: ENSNLEG00000003577   Transcript: ENSNLET00000004601
Sequence length 1503
Comment pep:known_by_projection supercontig:Nleu1.0:GL397407.1:2880738:3041138:1 gene:ENSNLEG00000003577 transcript:ENSNLET00000004601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESTSQEELRPAQENGKEDKERKWNLTEVKGLHETLQSVPDIPVKEATNNVVEKATDEV
KSQELNLEGQRKISPGSIKDSKTEASGNIAIRKSAKVIFALDETELKSKLEHTWKKNLFE
RMEARAQAMQQKIIDKENLKKELEKKPEKKLPRDNLAKEWFNTESMTLNNRAYLLDKLLP
TLVPGVENMLTQVEKKKVLTEADTPSNFDPINYLGEYLMRNNPNYIKDPGMSGYQRVMKE
VTEDLKIYVPDTICNRVSKMKENVKQNRKQRESIDKIKVKVANTRKQALQEQFDEWILDP
KGMIPKSVIQNVLHEFFQNPDFKLGSHCKQLDITDSTEPRLNKMEFTEYISSHIKDLKSE
MFEELLKHLCHSADEFREVIKADMRRQMFAELFLHCDHGKVGFLDRQRTLALLELFYDHS
SQMLRSLLQNPRQWPFIEFEEINLTELWGDMDNQKHIYEGFDKVLLEMNTLLSAKHASKT
QSKLLESPDQPKLNEQRTSTPPPNPPEQQRGVTAEQGPQRISTEEQEQGKKPTAEQELYT
ESVIEPGTHTESTLEQGSSRGLLTGQETHRESTTEQGQHKGSIEGQGPRRVSVSEQGLSR
ESVAEQGSRRESIAEQDRCKASVAEQGSRRMSAAEQGSLRESIIEEPYQKSEQGPYGKII
SEEQEDIGSTSQSRKDSFLKTTKYGESIPSEYIEVPLQEKRSWEQTYEKEIFLSSELQEE
VPTLSRKDHFSETTKKEVQKDKSCEPKSQKIEGKSWSGEFFTCNWKMKYVTFEDEEQANL
IYGNSRFTDLHSIIRNIQSCKEVKGRTAFSGVSFNLLQFVQLLETFVGEDAPLSVSETLT
SFFKEGYVETEQEKMNALEQFSQNAFQVRQRLLLEAIFQKWDSDGSGFLDLKEVDELLYT
YKEGMEKESMKKAKLHIQFPKPHPGQEVRLSSKQFQNYMELVVSELRGNEDQVLESVVEF
LMNALERSHTESLRNCARRKWLHQIQRAAETSGVSLEPVYSETFKALTQDAEAHGNKKIS
AHISLLEENLLLPEKGNVLLRNVACTLDDALFVLNRVLYRDMKGISFTVVDEGKPIHVPQ
VQYHGNIFFWNQSRNKNDYNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPHEIRF
YQGVANAFSTAYHYVHSREHILHIVITGIGWLYDVTSSITSITTYFVEPSPAQDSDYVLR
KMMVTGQLGLTEIHKNPPTIHRKSCIFRDFLFKCTDSSEVVLASACGETHIVVPLRERTG
EALGVLDFNIGQNRMLLCQEYKDLQKMMKVVQVACYEILGEFSGEIDKKYILEIENVGEV
QRAGILFFRIMLLELQESIQLLSSMEFVSLLLYDHTLLTEPNSPQDSKSIELEANVKLVR
DVLKAVILFFHPELEFSSDFGSWDKCKFYVNKYLVNSICAFDPTAKHVEVNVQLIDEYIR
GHSRTEVWKFGNVVIEHLYHWIHICSALTKITKQLNSAITPPLPSKTDNYMYAEVPGEGL
QEK
Download sequence
Identical sequences G1QTV4
ENSNLEP00000004372 ENSNLEP00000004372 XP_003277124.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]