SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004373 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004373
Domain Number - Region: 43-77
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00157
Family Toll/Interleukin receptor TIR domain 0.0096
Further Details:      
 
Domain Number - Region: 73-166
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0357
Family Gonadodropin/Follitropin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004373   Gene: ENSNLEG00000003628   Transcript: ENSNLET00000004602
Sequence length 168
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:10006959:10131961:-1 gene:ENSNLEG00000003628 transcript:ENSNLET00000004602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKEGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Download sequence
Identical sequences A0A2I3HLU6
XP_003267360.1.23891 ENSNLEP00000004373 ENSNLEP00000004373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]