SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004404 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004404
Domain Number 1 Region: 352-444
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-25
Family DEATH domain, DD 0.00000702
Further Details:      
 
Domain Number 2 Region: 101-144
Classification Level Classification E-value
Superfamily TNF receptor-like 5.14e-17
Family TNF receptor-like 0.0000669
Further Details:      
 
Domain Number 3 Region: 43-100
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000037
Family TNF receptor-like 0.0000149
Further Details:      
 
Domain Number 4 Region: 145-198
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000883
Family TNF receptor-like 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004404   Gene: ENSNLEG00000003619   Transcript: ENSNLET00000004637
Sequence length 455
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:6290500:6306610:-1 gene:ENSNLEG00000003619 transcript:ENSNLET00000004637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSTVPDLLLPLVLLELLVGIHPSGVIGLVPHLRDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECEGGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKSTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPTPSFSPTPGFTPTLSFNPMLSSTFTSSFTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPTPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLAAWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPEPGLLR
Download sequence
Identical sequences A0A2I3GEI2
XP_003273764.1.23891 ENSNLEP00000004404 ENSNLEP00000004404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]