SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004415 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004415
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000469
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004415
Domain Number - Region: 144-288
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0288
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004415   Gene: ENSNLEG00000003645   Transcript: ENSNLET00000004648
Sequence length 323
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:14480428:14528195:-1 gene:ENSNLEG00000003645 transcript:ENSNLET00000004648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLMITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE
Download sequence
Identical sequences G1QTZ5
XP_003261819.1.23891 XP_018879794.1.27298 ENSNLEP00000004415 ENSNLEP00000004415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]