SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004455 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004455
Domain Number 1 Region: 119-215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 44-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000005
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004455   Gene: ENSNLEG00000003694   Transcript: ENSNLET00000004690
Sequence length 262
Comment pep:known_by_projection supercontig:Nleu1.0:GL397407.1:3262353:3280705:-1 gene:ENSNLEG00000003694 transcript:ENSNLET00000004690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKSSVIMQMGRFILLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLTCAVQNHT
REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSISVVLNVT
FPPLLSGNDFQTVEEGSNVKLVCNVQANPQAQMMWYKNSSLLDLEKSHHQIQQTSESFQL
SITKVEKSDNGTYSCIAKSSLKTESLDFHLIVKDKTVRVPIEPIIAACVVIFLTLCFGLI
ARRKKIMKRCMKDKDPHRETAL
Download sequence
Identical sequences G1QU35
ENSNLEP00000004455 ENSNLEP00000004455 XP_003277129.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]